PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010542800.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family MYB_related
Protein Properties Length: 748aa    MW: 81904.6 Da    PI: 6.6981
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010542800.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.93.2e-152468147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     r rWT++E+ ++++a +++G   W +I +++g ++t+ q++s+ qk+
   XP_010542800.1 24 RERWTEDEHSRFLEALRLYGRA-WQRIEEHIG-TKTAVQIRSHAQKF 68
                     78******************88.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.39E-151872IPR009057Homeodomain-like
PROSITE profilePS5129418.3231973IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.5E-72170IPR009057Homeodomain-like
TIGRFAMsTIGR015575.1E-172272IPR006447Myb domain, plants
SMARTSM007171.0E-112371IPR001005SANT/Myb domain
PfamPF002491.8E-122467IPR001005SANT/Myb domain
CDDcd001671.54E-82669No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 748 aa     Download sequence    Send to blast
MEKNISGEEL VTKIRKPYTI TKQRERWTED EHSRFLEALR LYGRAWQRIE EHIGTKTAVQ  60
IRSHAQKFFT KQPYAWKAST WMRFAVDASI ELHKKLLEKE AQAKGIPICQ ALDIEIPPPR  120
PKRKPSNPYP RKTGNGESTS QVSSAKVVKL DSSASFSHCN QALDLEKKPF TEKPNGVEKV  180
PNGNGNQDDN CSGVSARPTE AHCSSISSVN KYPFPNKAAP RNPSSFRESE PDLTKATADN  240
GTSKTSNADN SCYSQDNDAN VLPHISISKE DNGVNGLSPV GNMNGIQSYP WHFPVHVLNG  300
NVGTYPQNPP GMGFQDFMFR PVGEVHGHSG LFTIPSTSAT SQHQDNVPRS SRQAFPAFHP  360
AFVPACHTQD DYRSFLQISS TFSNLIMSAL LQNPAAHAAA TFAASFWPYG NVGSSNDSST  420
STTIQTDGAF PPRQMSSPPP SMAAITAATV AAATAWWAAH GLLPICAPFT CLPMSAPIVP  480
PSVSAQTELP ETDKKDAATA NPQQPAMEQG EAQVLASPFE SDDDLDENGR TEQDTGLKTE  540
DHKEKVVEVQ EQVQDSNTTQ KKKQVDRSSC GSNTPSGSDV ETDALEKAAE KDKEEDVKET  600
DGNQTGTESS TRRTSRSKDN SSDSWKEVSE EGRMAFDALF ARERLPQSFS LALDVEKESP  660
EKGKGNREER EREMAHKSKI QDSCSKETAS RSEGNGGITI GIGEGKSLRA RRTGFKPYKR  720
CSMEAKESSS QAEEKVSKRI RLDSKAST
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00654PBMTransfer from LOC_Os08g06110Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010542800.10.0PREDICTED: protein LHY-like isoform X1
RefseqXP_010542801.10.0PREDICTED: protein LHY-like isoform X1
RefseqXP_010542802.10.0PREDICTED: protein LHY-like isoform X1
SwissprotQ6R0H10.0LHY_ARATH; Protein LHY
TrEMBLA0A061DT310.0A0A061DT31_THECC; Homeodomain-like superfamily protein isoform 1
STRINGAT1G01060.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM55762645
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01060.41e-144MYB_related family protein